PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G207000.1.p
Common NameSb07g027420, SORBIDRAFT_07g027420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 1120aa    MW: 122215 Da    PI: 7.6076
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G207000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.8e-40177254178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cqv++C+adl++ak+yhrrhkvCe+hsk+++++v+++ qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+q+
  Sobic.007G207000.1.p 177 MCQVDDCRADLTSAKDYHRRHKVCETHSKTTKAVVANQAQRFCQQCSRFHPLAEFDEGKRSCRRRLAGHNRRRRKTQP 254
                           6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-34171239IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.864175252IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-37176255IPR004333Transcription factor, SBP-box
PfamPF031106.2E-30178251IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1120 aa     Download sequence    Send to blast
MQREVGPQVA PPLFLHQIQP MPPHAAAAKK RGHPWPAAAG AAVAPAEAAA GNWNPRLWDW  60
DSRALTARPS SDALRLAGGQ QPQPSAKAAE AQRQGTAGGN GALNLQLGLR EDAATPMDAS  120
PTAPAASSSP SPPPASASAG QEPVVRPSKR VRSGSPGSAG GGSGGGGAAN GGAGYPMCQV  180
DDCRADLTSA KDYHRRHKVC ETHSKTTKAV VANQAQRFCQ QCSRFHPLAE FDEGKRSCRR  240
RLAGHNRRRR KTQPTDVASQ LLLPGNQENA ANRTQDIVNL ITVIARLQGS NVGKVPSIPP  300
IPDKQNLVEI ISKINSLNNT TSAAKSPPSE VVDLNASQEQ QEQRQDSVEK TTNGIDKQTV  360
PSTMDLLGVF STGLATSTPE TNTSQSQGSS DSSGNNKSKS HSTEPATVVN SHDKPTRDFP  420
AAGFMRSNST HESRPHIYKQ IEQETRPYLS LQLFGSTEAD IPPKMDSVNK YLSSESSNPL  480
DERSPSSSPP ITRKFFPIHS VDEEVRHPHI TDYGEDATMG EVSTSQAWCA PPLDLFKDSE  540
RPVENGSPPN PGYQSCYAST SCSDHSPSTS NSDGQDRTGR IIFKLFGKEP STIPGNLRDD  600
IVNWLKHSPT EMEGYIRPGC IVLSMYLSMA AIAWDELEEN LLQRVNSLVQ SSDMDFWRKG  660
RFLVRTDSQL VSYKAGMTRL SKSWRTWNTP ELTFVSPIAV VGGRKTSLIL KGRNLSIPGT  720
QIHCTSIGKY ISKEVLCSAY PGTIYDDSGV ETFDLPGQPD LILGRCFIEV ENRFRGNSFP  780
VIVASSSVCQ ELRNLEVELE DSQVLDVPSD GQIHDSRQSK TRVQVLHFLN ELGWLFQRAS  840
ACTLSTRSDM SDLDLIKFST ARFKYLLLFS SERDWCSLTK TLLDILAKRS LVSKELSKET  900
MEMLAEIHLL NRAVKRKSRS MVHLLVQFVV ICPDNSKVYP FLPNLPGPGG LTPLHLAASI  960
ENAEDIVDAL TDDPQQIGLT CWQSVLDEDG QSPETYAKLR NHNSYNELVA QKLVDVKNNQ  1020
VTITVNGDEI CMDQLGNVGD HKQSGVQALQ IRSCSQCAIL ESGVLRQPVR SRGLLARPYI  1080
HSMLAIAAVC VCVCVFMRAL LRINSGKSFK WERLDFGTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-33168251184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.81310.0embryo| leaf| panicle| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445883.10.0hypothetical protein SORBIDRAFT_07g027420
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLC5YIN80.0C5YIN8_SORBI; Putative uncharacterized protein Sb07g027420
STRINGSb07g027420.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Representative plantOGRP71381115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14